PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 173aa    MW: 18705 Da    PI: 9.3088
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021723.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.2e-1598154561
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                 ++ +r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk + ++lk e+a+l +
  Do021723.1  98 RKNIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRQCKQLKVEMAALIQ 154
                 6889********************************************999998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.4E-1593154No hitNo description
SMARTSM003381.2E-1394158IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.64596152IPR004827Basic-leucine zipper domain
CDDcd147073.96E-1698152No hitNo description
SuperFamilySSF579591.06E-1198153No hitNo description
PfamPF001701.7E-1298153IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MPRSPQLSLS GCSSLFSLSS TSTSRDNDSA AAAPVPPPPP SLHPLPPRGP LLSLSVGGGG  60
GDEEQEDEEE YLLSGLDLQL TGAGGSNSSG RCDGDDERKN IRMMKNRESA LRSRARKRAY  120
VQELEKEVRR LVNENLKLKR QCKQLKVEMA ALIQASSSKS SSHIRRTSSS TQL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0701221e-107BT070122.1 Zea mays full-length cDNA clone ZM_BFc0109J06 mRNA, complete cds.
GenBankEU9563241e-107EU956324.1 Zea mays clone 1560828 bZIP transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961973.12e-61PREDICTED: protein FD-like
TrEMBLK3ZA772e-61K3ZA77_SETIT; Uncharacterized protein
STRINGSi023448m6e-61(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.17e-15bZIP family protein